Words Starting With PIC
There are 273 words that start with PIC, from 4 letters to 15. The highest scoring is PICKABACKING at 29 points in Scrabble, and 26 of them carry a J, Q, X or Z.
The List
Most common words first, then the rest A to Z.
PICTURESPICTUREPICSPICKPICKSPICKEDPICKUPPICKINGPICNICPICTUREDPICTORIALPICTURESQUEPICKLEPICKUPSPICKERPICAPICACHOPICACHOSPICADILLOPICADILLOSPICADORPICADORESPICADORSPICALPICAMARPICAMARSPICANINNIESPICANINNYPICANTEPICARAPICARASPICARESQUEPICARESQUESPICARIANPICARIANSPICAROPICAROONPICAROONEDPICAROONINGPICAROONSPICAROSPICASPICAYUNEPICAYUNESPICAYUNISHPICAYUNISHLYPICAYUNISHNESSPICCADILLPICCADILLIESPICCADILLOPICCADILLOESPICCADILLSPICCADILLYPICCALILLIPICCALILLISPICCANINPICCANINNIESPICCANINNYPICCANINSPICCATAPICCIESPICCOLOPICCOLOISTPICCOLOISTSPICCOLOSPICCYPICEPICENEPICENESPICEOUSPICHICIEGOPICHICIEGOSPICHOLINEPICHOLINESPICHURIMPICHURIMSPICIFORMPICINEPICKABACKPICKABACKEDPICKABACKINGPICKABACKSPICKABLEPICKADILPICKADILLPICKADILLIESPICKADILLOPICKADILLOESPICKADILLSPICKADILLYPICKADILSPICKANINNIESPICKAPACKPICKAPACKEDPICKAPACKINGPICKAPACKSPICKAROONPICKAROONSPICKAXPICKAXEPICKAXEDPICKAXESPICKAXINGPICKBACKPICKBACKEDPICKBACKINGPICKBACKSPICKEDNESSPICKEDNESSESPICKEERPICKEEREDPICKEERERPICKEERERSPICKEERINGPICKEERSPICKELHAUBEPICKELHAUBESPICKERELPICKERELSPICKERELWEEDPICKERELWEEDSPICKERIESPICKERSPICKERYPICKETPICKETBOATPICKETBOATSPICKETEDPICKETERPICKETERSPICKETINGPICKETINGSPICKETSPICKIERPICKIESTPICKILYPICKINPICKINESSPICKINESSESPICKINGSPICKINSPICKLEDPICKLERPICKLERSPICKLESPICKLINGPICKLOCKPICKLOCKSPICKMAWPICKMAWSPICKOFFPICKOFFSPICKPOCKETPICKPOCKETSPICKPROOFPICKTHANKPICKTHANKSPICKWICKPICKWICKSPICKYPICLORAMPICLORAMSPICNICKEDPICNICKERPICNICKERSPICNICKINGPICNICKYPICNICSPICOCURIEPICOCURIESPICOFARADPICOFARADSPICOGRAMPICOGRAMSPICOLINPICOLINEPICOLINESPICOLINICPICOLINSPICOMETERPICOMETERSPICOMETREPICOMETRESPICOMOLEPICOMOLESPICONGPICONGSPICORNAVIRUSPICORNAVIRUSESPICOSECONDPICOSECONDSPICOTPICOTEPICOTEDPICOTEEPICOTEESPICOTINGPICOTITEPICOTITESPICOTSPICOWAVEPICOWAVEDPICOWAVESPICOWAVINGPICQUETPICQUETEDPICQUETINGPICQUETSPICRAPICRASPICRATEPICRATEDPICRATESPICRICPICRITEPICRITESPICRITICPICROCARMINEPICROCARMINESPICROTOXINPICROTOXINSPICTARNIEPICTARNIESPICTOGRAMPICTOGRAMSPICTOGRAPHPICTOGRAPHICPICTOGRAPHIESPICTOGRAPHSPICTOGRAPHYPICTORIALISEPICTORIALISEDPICTORIALISESPICTORIALISINGPICTORIALISMPICTORIALISMSPICTORIALISTPICTORIALISTSPICTORIALIZEPICTORIALIZEDPICTORIALIZESPICTORIALIZINGPICTORIALLYPICTORIALNESSPICTORIALNESSESPICTORIALSPICTORICALPICTORICALLYPICTURALPICTURALSPICTUREGOERPICTUREGOERSPICTUREPHONEPICTUREPHONESPICTURESQUELYPICTURESQUENESSPICTURINGPICTURISATIONPICTURISATIONSPICTURISEPICTURISEDPICTURISESPICTURISINGPICTURIZATIONPICTURIZATIONSPICTURIZEPICTURIZEDPICTURIZESPICTURIZINGPICULPICULETPICULETSPICULS
Common Words Starting With PIC And What They Mean
The most familiar words on this page and what they mean. Tap any word for its full entry, score and anagrams.
- PICTURES noun form of PICTURE: a visual representation (of an object or scene or person or abstraction) produced on a surface
- PICTURE noun a visual representation (of an object or scene or person or abstraction) produced on a surface
- PICS noun form of PIC: a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement
- PICK verb select carefully from a group
- PICKS verb form of PICK: select carefully from a group
- PICKED verb form of PICK: select carefully from a group
- PICKUP noun a light truck with an open body and low sides and a tailboard
- PICKING noun the quantity of a crop that is harvested
- PICNIC noun a day devoted to an outdoor social gathering
- PICTURED adjective seen in the mind as a mental image
Definitions from Open English WordNet, CC BY 4.0.